SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT25863 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT25863
Domain Number 1 Region: 169-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000687
Family B3 DNA binding domain 0.0098
Further Details:      
 
Weak hits

Sequence:  EMT25863
Domain Number - Region: 53-97
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0106
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT25863
Sequence length 272
Comment pep:novel supercontig:GCA_000347335.1:Scaffold15204:3966:6002:-1 gene:F775_24290 transcript:EMT25863 description:"Uncharacterized protein "
Sequence
MKMVCAICHSHCESDIEQTFRIVIRDDYEALANIPCTARNRFNQMSGLNFKADGRRYVVD
VYRGHKTTLIGGDDWAKFKHDFDVGQGNVVVFDMTGRTAKAYVAGVEAEEQGGAAEEVVA
VDEEEEVVNDDHGLEDALAFVNTRGFVFEDGEYAMMELILTIQHLYIGPPFVHRLTPTII
AGKLMKIPKKVAQPLNLDTEGVLGLCMGVGDVMQVAYHTDRDGRIVFNQAWGVFVAQNHL
QVNDAVVFNFREINEEHINLVCVVNALRPAEP
Download sequence
Identical sequences M8BVM5
EMT25863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]