SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT25952 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT25952
Domain Number 1 Region: 164-230
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.72e-29
Family B3 DNA binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT25952
Sequence length 394
Comment pep:novel supercontig:GCA_000347335.1:Scaffold15050:48831:51695:-1 gene:F775_20129 transcript:EMT25952 description:"Auxin response factor 2 "
Sequence
MIGIDLNTVEGDEEEGGPSAEPPRGTVCLELWHACAGPVGPLPRKGSAVVYLPEGHLEYI
GEAAGAVAAVPPHVFCRVVDVNLQVRARARGLVLVLYGVRRDHNVFEVLTDRACSLQADP
ATDEVYAQVSLVVDNEEAKRRMRQGESEEACEGDGEDTDAAKRRARMPHMFCKTLTASDT
STHGGFSVPRRAAEDCFPPLDYNLQRPSQELVAKDLHGTEWRFRHIYRGTATAIHWLIAY
SSGSAYLSGFPPEIYRMLRHIMRGEDGVLRLGVRRAAQLKNVSPVPALFNQDSSLSSLGN
VAQAVAVKSIFHIYYNPRLCESEFIVPYWKFMRSFSQPFSVGMRFKMKYENEDASERRST
GTITGSRESDPKSHGSKWKCLVLADYSMPSLNFE
Download sequence
Identical sequences M8CFM4
EMT25952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]