SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26046 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26046
Domain Number 1 Region: 234-309
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000122
Family B3 DNA binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT26046
Sequence length 607
Comment pep:novel supercontig:GCA_000347335.1:Scaffold14856:37147:42454:1 gene:F775_02635 transcript:EMT26046 description:"B3 domain-containing protein "
Sequence
MAGSWFLRTCLETSDELFSRAVLRSVGEVGWNGKCTFFTGKMKKRGRPAGGGSPSVNNSE
RDKMVMEKKMALVHRRLALLDSESDKETDVVPTATMDDRLAIVVDQQPVVINCDDTDDKD
EYVPLRIVRPRRADSEQKRLFDVSQTHNAQDTDTAKKKRGRLVNAKSDMEQKLNMSTPGL
ALVESGGSNSSKSDVDDDLVPMVAAVNCQKTCTSVQGNFGSAMERAEELLVELPAEHPSF
VKHMLHSHVVHGFWLGLPSDFCNKHLPKKDTAVVLEDEDGHNYDAKYLGAKQGLSAGWRG
FAINHDIKVYILRANNFTTTDGALGLLCLEAGKEKIPKEESSNDVKSEAGKEKIPKEESS
NDVKSEAGKEKIPKESSIDVKSEAGKEKIPKEESSIDVKSEEKPKVAQSDSSNLASESIT
DGIKFSDTAIDFDDVKDFSSFSIIVDGLAIDCEFPDQQRETYYELCCAQKSFLHKDLLKG
LNITLVVGAIMETIDIAEGIRACKARVPSRKDFVVWKKNLQALKLLGMNVDFLLKRVDGL
LSLPARPRAPAEVKLERARTVAKIKEVESRISSVKDTLEEIDVEMEEMESSAKIVDEMMQ
LLATAPW
Download sequence
Identical sequences M8CQV7
EMT26046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]