SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT26093 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT26093
Domain Number 1 Region: 730-831
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-19
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 311-408
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-18
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT26093
Sequence length 1143
Comment pep:novel supercontig:GCA_000347335.1:Scaffold14799:45343:53307:1 gene:F775_20501 transcript:EMT26093 description:"B3 domain-containing protein "
Sequence
MTEEFEMSMIGELTFFLGFEVKQRRGGTFINQAKYTQDMLKRFNLDDVKLVKFPMPTKCK
LDIDPNGKAVDQKPPVAVSLAPVCPPALQICGSLSNSLRGGLVLPDLFPWTPYNATFLFS
CDNRCVDSYAIPFLSQGKDEREVHAISKGPIMVRHQKQCNTMGMVDNKKNVKVKEEKDEN
INTKEKRKQKKAEGDKKTEEKQNSSERKMTKNKEEKEKKMRVVDKKDDEEKEREDQRKRK
ENGRKAMSHKERKEENGNEKEEQGQEGKEGEIEKEKEEEQKEINEQKGRKENGKEEHDSK
ERDEEDQNDKQNCPHFFRALISNSFMEHVTIPAGFHKYLEDCTGMVSLRGPSGNKWPVEL
AKISGELCFARGWKEFLSDHRVGYGYLLVFRYDGQSQFSVTVFLPSSCEAPYASLAQPQH
KDIDVAREEEKGLISTNVDDTVPQEDARSGTSVDGTPQNEASEVEEDASEDEEAEEVEDA
LSETPENEQDYERRMSSNDALEPEQQQQDDQHKTDDGFVVGKRARFRKLDDIMAEVDRSK
KSRPTEGKNSEAPSGDPASGGTSSSDSLAESEHRPPMKSKAEEIRSPSGDSASKAAASSD
NLAELASRPSKDSKAEGKSSTAPLIFYTRSTASASKRVPLKKASKETTSSDNWAGVFTPE
SMCTDLTTWHKSFGKRLSKQNQFPMFNKSNGENQPGRVLIKVMRRPGLTSQGRPVTEREK
EYAMERAQRFKSERPFTVKTMKHNDVYASYFMIIPDKFVKTFLPEESRKMTFWDPQGKPW
KVWYEYTGGECPRAAFSAGWGALAMENNLEKWDVCIFELLDQEYNIKLHVYKVVLEITPC
VIAPKPLIVFGLLVDDHLAMGESQAIMCVKRFAVGIVQVFGPEYLRSPNTKDAGRLLEMN
KARGFPGMLGSIECMHWSWKNCLKAWHGQFHGQKKGSIIILEPVVDQETWIWHTFFGMPG
SLNDINVVNWSPLMNNIANGELPPVQFVANRHTYSYGYYLVDVIYPKWQTFVKPLKKPEG
KKNLDFHNAQAAAGKDVERVFGILLAQFAIVGRPARFWDQKILWYIMHACVIMHNMIIEN
ERGQDSDYSQYELLGHPVRVRRRAARVARFVASYHAIRRAETHDDFRKDLIKEWWAWNGR
QNA
Download sequence
Identical sequences M8BW80
EMT26093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]