SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT27996 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT27996
Domain Number 1 Region: 705-785
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000188
Family B3 DNA binding domain 0.0041
Further Details:      
 
Weak hits

Sequence:  EMT27996
Domain Number - Region: 576-764
Classification Level Classification E-value
Superfamily YWTD domain 0.00798
Family YWTD domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EMT27996
Sequence length 847
Comment pep:novel supercontig:GCA_000347335.1:Scaffold11030:11754:38566:-1 gene:F775_42806 transcript:EMT27996 description:"Uncharacterized protein "
Sequence
MEQWWQLPVLRCSALAGDASAARSPEQVTRFPLREEFDESLEQPDPIPLLVLLENGARNV
GPGIGQKPAVARRRRDLADRDRGDADLRARLADSDARLLAALDENAKLVKERDTLALTAK
KLSRNLAKGVWAAGPRGRRQQQQLAMVESTTDHHHQYEWSGPVEAFEQAAREFEDKLGRT
ETKIHLFPASMVDLAERYAAPRTVSIGPYHHGWSHAVLQMESTKHVASWHFVRASGRSVE
EVYSAYLLYASTYGGDDEDEGMAVDPALRSAFSSDSDRIFSDVVLLENQLPWVVVETLMS
FAPAPGLDLPKLVGRVKGSLQARQALDEKPPAWDSSYTPPHLLGLLRYYIVGTGTKLSSE
SSRGLSEKAEKVSISVSAVELAEMGIQLTATKTGAELKEMGVRKGLLSGELFLAPLSLDD
ANAGFLVNMAALELCTTPDFSEAGEERSTVCSYLCLLGMVTDRVEDVQELRTNHILQGGA
GLTNEDALRLFISLEKHLRPGRCYLRTMLDIENYRVHRPVRTMVYRVWRPAMSRLPAPPP
VPLLLLSPCEARTGAQLVGTKHLCGPDDSWVVRVPDKADGKLFVGSHEGGWVAAVDWRTL
VIVNLFSDAEVVEASPIRSPKLEHIAPNCHRKIIFSEDPTSSSCILAAIPHRWSYVAVCK
VGGDTSGWTVEKMGEKTIMDIAFCNGELYGLMYPNEELVKFEINIKRLPDTFTEMLDDHQ
PKNVKLRQPDSGLRRLWDVEVVIRNDHMYLCRGWEQFIRAYDPRHRYFLVFRYDGDAMLT
MKAIRAATTTLATAKAAASLATAKAVARMIRNGEGKKRSRVGMRRCSLFCLTMTSRWWWL
TMAKRWW
Download sequence
Identical sequences M8CVY8
EMT27996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]