SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT28125 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT28125
Domain Number 1 Region: 44-139
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-17
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 199-295
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000118
Family B3 DNA binding domain 0.0044
Further Details:      
 
Weak hits

Sequence:  EMT28125
Domain Number - Region: 366-435
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000165
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT28125
Sequence length 515
Comment pep:novel supercontig:GCA_000347335.1:Scaffold10767:140450:143503:1 gene:F775_02021 transcript:EMT28125 description:"B3 domain-containing protein "
Sequence
MTYMNSLHVFTFHFFCAAGGQAKTMSPSCGRCTQRDEYNYKNLEDENKHFLVLMLGDFRQ
QMIISKEWVRCLKGEIPDEIKLETRNRASYTIKVAKYQEKHVLKVGWPQFVENFHLQLGD
SLLFRYNGDSLFSIVIFDKLGREKASSVLVDPFPPQVQGRRGKNKSHLKWLLHCRSARKM
NALCETCEIWDEHHYMNLDDEKKYFLMRMTGDFQDKMIIQKEFVQRFKGEIPGEIELETK
NKCRYIIQVIKNQEEQLVLAAGWGSFVQKFRLEMGDRIILFGYNGNSWFSVIILDQLGRE
GDGSFSSHDHVRNALGFRRVVRRNRTSSQKQQQKKDGYITTDKTKLTPAQEQQVKDMVQT
IRSRRSGITIFVALIGKANVHPGFSLTVPIMYGQEHFGDGKVICFQLGEKKWNASFNGSR
KYYRIESGWRSFRIKRGDLILGNMSNNEETGPSNHDADEMDYEGEQQYLDFLSAKHSQGL
RGGLDDGTDADIGTDGGAKTGGEGISTEAATENKK
Download sequence
Identical sequences M8BSZ1
EMT28125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]