SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT29437 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT29437
Domain Number 1 Region: 14-568
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.44e-96
Family Acetyl-CoA synthetase-like 0.00000821
Further Details:      
 
Domain Number 2 Region: 794-1150
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.77e-38
Family Quinoprotein alcohol dehydrogenase-like 0.0088
Further Details:      
 
Domain Number 3 Region: 586-650
Classification Level Classification E-value
Superfamily ACP-like 0.00000221
Family Peptidyl carrier domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT29437
Sequence length 1153
Comment pep:novel supercontig:GCA_000347335.1:Scaffold8197:42691:50937:-1 gene:F775_01630 transcript:EMT29437 description:"Acyl-CoA synthetase family member 4 "
Sequence
MAAAAAASAEADEPCCISHAFDRAARRDPARLAVVHAGDGRRRFACGDLLSAVSSLSRRI
AAALPRPSTDHPGDDGSPGCLDRHGGSTGAMPRLVGVYASPSAEYVAAVLAVLRCGEAFL
PLDPSWPEDRVWSAVSDSNAALVVSAGVSHEDDVLKGCSCPVLRLNGDIRQGFDDVVGGD
ELVWPCERERPREFCYVMFTSGSTGRPKGVCGTEKGLLNRFLWMQRRNPLCSDDVLLFKT
SVSFVDHLQEFLSAVLTSTTLVIPPIDWRANPTSLANLIKTYRISRMTIVPSLMEMILPT
MEKNISCGYNSLKILVFSGEILSLVLWKRVREILPETTVVNLYGTTEFTPHRDWLKVSGD
CTFFDCKDLPAILECEEITSVPIGFPIANCEVVLVTHAGMADEGEICVSGACLFNGYLAE
FLMSNHTEGSESSTYYKTGDYARRLKAGELVFLGRKDRTVKNYGQRFSLEEVESTLKEHP
AVSDAAVTFQSKGSPDYKAYLVFKNKDGIVKDSLQYREVNSSQDIMASIRSWLIKKVPPA
MIPSFFLHVKSLPLTSSGKVDYVKLSSLECALEPCGNEQIKSGSGPVNPYLQVIKKAFCD
TLLVDEVSEFDDFFTLGGNSISAAHAAHKLEIDMRLLYIYPTPSKLLHALVVEDSNLVSP
TDEPQPKKDLNVSTSIHGLFDLSAANADDSYHGGKAQINGKRAHYQIAESYGDETDGQLN
KYPFSSDDRYQVNDLYLDTGLKDRNSVIGSQWILNFCLHKKWSIGRCNRFMHDDEGKLQL
EDVCLHVSYNKRGYLQELWNIPLDSCVDASPLLVLNNGMINIFIGSHSHLFLCIDGCNGS
VRWSVKLEGRVECSAAITGDFSEVVVGCYKGKIYFHDMLTGKLSWTVQTDGEVKMQPVVD
RTRNLIWCGSYDHHLYALNYKDRCCAYKVSCGGSIYGSPAVDMAHDRIYVACTSGLVTAI
SLEVPSFRIVWQYEAGAAIFSSLAIDHQSGNVVCCLVNGLVIALNSHGTVVWKATVGGPI
FAGACVSCALPSQVLIPSRDGSLYSFDITSGDLLWSYDVGDPITASAFVDEVLASRPSGA
SERFACICTSSGKVRVLGIRADAEQEKDGYSLQEFAAMDLPGDIFSSPLMVGGRILVGCR
DDRLHCLSITSHP
Download sequence
Identical sequences M8CPJ4
EMT29437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]