SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT29641 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT29641
Domain Number 1 Region: 285-564
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-55
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 
Domain Number 2 Region: 1126-1221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-25
Family B3 DNA binding domain 0.0000814
Further Details:      
 
Domain Number 3 Region: 544-566,683-981
Classification Level Classification E-value
Superfamily RNI-like 7.85e-17
Family 28-residue LRR 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT29641
Sequence length 1248
Comment pep:novel supercontig:GCA_000347335.1:Scaffold7776:60413:64919:-1 gene:F775_09801 transcript:EMT29641 description:"B3 domain-containing protein "
Sequence
MDLTEKDKEEPARKRRETGQVLDPVRIVGKKRRNNDDGILEEDCKNVLLDDPTTATVSDP
VIESSAKNEVEQSGAQLLVLEEACLFTSSDISTLFDGSVSSSLGSMRPLGEKLDKLLAPA
QEYYRRLPKRTKEGMHLLKDDVEVISSYLDELSEVEDPPPMAMCWMNEARDLSYDMEDYI
DSLLFVPPDRFFKKKKKKGRRKKMMIKKMLKWYKQVAFTAQVSEHGIMTSKIIHVNVPRL
PSKPKIAETISEFRIYVQEAIERHNRYKLHCCSNLRRRTFLSTGRMLPMPYEETDDHVVI
DGQMNEFINSLAANDAADQQQLKVVSVLGTGCLGKTTLAKVLYNRIGMQFDCRAFIRVSK
KPDMKRLLRDLFSQLHQKKQPLPTNCNELGISDINIRKHLQDKRYLIVIDDLWDASVWDI
IKSAFPKGNRGSRIIITTQIEDVASTCCCDHSEHVFEMKPLDDDHSRKLFFSRLFGSESD
CPEELKQVSNEIVDICGGLPLATINIASHLANQETEVSMDLLAYTRDALRSYLWSNSTSE
RTKQVLNLSYNNLPHYLKTCLLYLNMHPEGSIICKDDAVKQWVVEGFIAPRKGKEQGQDW
MEKVAGIYFDELIDRRFIQPLYINYNNKSAEENFIVVVDYNRKNIALTHKVRRLSLIFGD
GKYAKTPENITKSQVRSLRYFGLFKCMPCIREFKVLRVLNLILSGHCGDYDPIDLTGISE
LFQLRYLKIASDVCIKLPNSMRGLKCLETLDVMDATRVTAVPWDIIQLPHLLHLILPVDT
NLLDLVGNLSDSVIHQWSLGKLNCLQDLHLTFSSTSPDDHLETSMEVLAYLIGGHGNLKT
VVIAHGSLVENTVVPGASKVIPPWYRMAPPPLLQRLEFSPHSCCIFSRIPPWIEKHGNLC
ILKIPLRELKMICIDTLGGLCALTALSLYVETPPIQKIIFDKAVGFSVLKHFKLRFTTGI
ACLKFEEDAMPNLLKLKLVFNAIPPMGQPFFFRMGQVRQKVQHEHGTAVISIEHMPGLRE
ISTKFGGTASDLEYASRTVVSNHPSNPTIKMQLVGYSSNVDRSTKQKQQPDDILEEQPDG
EYDKRLERSADQRISTSLESNLRLDVPEITPTLVQITGGGDDVREHMFDKVVTASDVGKL
NRLVVPNQFAEKYFPLDVAANEKGLLLNFEDRGGKLWNFRYSYSNNSQSYIMTMGWSAFV
RDHHLATGDTVSFYRAGTRLFIDCRVRGQILAPVTQAVMPASASPALK
Download sequence
Identical sequences M8D0F0
EMT29641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]