SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT30362 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT30362
Domain Number 1 Region: 2301-2610
Classification Level Classification E-value
Superfamily BEACH domain 3.01e-116
Family BEACH domain 0.0000000138
Further Details:      
 
Domain Number 2 Region: 2732-2801,2842-2957,2996-3043
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.13e-28
Family WD40-repeat 0.0059
Further Details:      
 
Domain Number 3 Region: 2207-2286
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000105
Family PreBEACH PH-like domain 0.015
Further Details:      
 
Domain Number 4 Region: 513-653
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000475
Family Clostridium neurotoxins, the second last domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT30362
Sequence length 3075
Comment pep:novel supercontig:GCA_000347335.1:Scaffold6408:80196:100164:1 gene:F775_10031 transcript:EMT30362 description:"Uncharacterized protein "
Sequence
MAEDAHEMRDSSPPPPEQGPSVPLADEAGAEAAPSSPGTSAATPTSPPAPREQGSVEQLT
PLPFTDEVGVEEAASSQETSTGTSAPLPTARQQGPVAEQFAAVPLTDEVVVEEGLSSQET
SSGMPEPSPVPQEQGSVQQFAAVSLSEEVGVEKGTSTPKTSTGTPEPSPVPQEQGSVQQF
AAVSLSEEVGVEKGTSTPKMSTGTPTMPPDPSPPLRSRHRPPGVPADAPQEVVRAVDAAV
VGNRGGGMDCLLEMVSEGQGELPHSVVDVLLGTMGGVDGLDEVRDTTGTGTSPSIMSNSG
AAITAAELLPHLPFSEEPSPRTRMAVGLHAALRACTRNRAMCSSSGLLAVLLESAEKLFV
GTGRSSTSPSSWDGTPLLQCIQLLGGHSLSVKDLHSWLGLVKKVLGTSWATPLMLALEKA
MGSEEARGPAATFEFDGESSGLLGPGDSRWPFSSGYGFATWIYIESFSDTLSTATAAAAI
AAAAAATSGKSSAMSAAAAASALAGEGTIHMPRLFSFLSSDNQGVEAYFHGQFLVVESGG
GKGKKASLHFTYAFKPRRWYFVGLEHTNKHGLLGKGDSELRLYVDGSLHESRAFDFPRIS
KPLAFCCIGTNPPPTIAGLQRRRRQCPLFAEMGPIYIFREPIGPDRMSRLALRGGDILPT
FGNGAGFPWKATNDHIKNMAEESFALNHEIGGSLHLLYHPSLLSGRFCPDASPSDWVPLS
TDNGTKTREKHPCANFKAIQTGTHRRPAEVLGLVHVSPHVRPAESLWALAYGGPMALLPL
TVSGVQMDTLEPALGELSLSLATASLSAPIFRIISLAIQHPGNNEELCRTCAPELLSRVL
HYLLQASSKLGSGEKEGVTNEELVAAIVSLCQSQRNNHELKVQLFRTLLLDLKMWSSCNY
GLQKKLLSSLADMVFTESICMRDANALQMLLDGCRRCYWAIREPDSIDNLPLTGTKRSLG
EVNALIDELLVVIELLLGAVSSTAASDDVCSLIGFIVDCPQPNQVARLLHLIYRLIVQPN
ISRANMFAQSFISSGGVEALLVLLQREAKAGNNHILDNSANLSECDVVSNEGSDAKAMTG
EGYYQDDESQLAEQHESIVHEDTEQEAAKTNGASFKMLGAKIGRKISNSENQLIKNLGGI
NFSITADNVRNNVYNVDKSDGIVVGIIRILGALVASGHLKFASSSSNPNLPDGLLTTVHD
EGNTMSEDRVSLLLFALQKAFQAAPRRLMTANVYMALISAAINVSSADENLNLYDCGHRF
EHIQLLLVLLRTLPYAPRSFQARAIQDILFLACSHPENRTTMTTIAEWPEWILEVLIYNH
EKGSKKYVDGVSIGEIEDLVHNFLIIMLEHSMRQKDGWRDVEATIHCAEWLSLIGGSSTG
DQRFRREQSLPIFRRRLLGDLLDFSARELQVQTEVIAAAAAGVAAEGLSPEEAKVQAENA
AHLSVALAENAIVILMLVEDHLRTQGQHYCVSRVLNSVFSSASIASSAPSRTNSLSRAGS
EHMDTGLSRRSSLSSDAGGLPLDVLTSMADANGQISAAVMERLTAAAAAEPYESVKHAFV
SYGSCIADLAESWKYRSRLWYGVGVPSKSDLFGGGGSDLESWRSVLEKDSNGNWVELPLV
KKSLEVLQALLLDDSGLGGGLGIGGGSGPGMGVMAALYQLLDSDQPFLCMLRMTLVSMRE
DDNGEGDALLKNTSIKDVISEGSLVPFDGNSHSSTRKPRPALLWSVLGPILNMPITESKR
QRVLVASSILYSEVWHAISRDRSPLRKQYIELILPPFIAILRRWRPLLAGVHELTSYDGR
NPLIADDRALAADALPIEVLTGSFLKLTIRCCQAALSMISPGWAAAFASPPVAMALAMMA
AGASGTETVTPRRNTLSRHDTSLPERKAAARLQTFSSFQKPVETMHNKPGSIPKDKAGAK
AAALAATRDLERTAKIGSGRGLSAVAMATSGQRRSASDIDRAKRWNTSEAMSAAWMECLQ
SADSKPVSGREFSTLSYKYVAILVSGFAFARNLQRVEMERQTQADVLNRHRASTGVRAWR
HLLHCLTEMGRLYGPFEEPLCTPDRIFWKLDFTESSSRMRRFMKRNYKGSDHLGAAADYD
DRKLLSAAVQSNECNPKGADSSLTDTIPSTASVVIAEAMSVDDRNEDIEQLESDTTHSSA
DQLQSSSADQQSMKRSVDSRSSGISADRNLVRSTVVAPGYVPTEADERIIVELPSLMVRP
LKVVRGTFQFPLKLLAGIIHTCNFVPRYLLRRSALELFMVDRSNFFFDFGDMEARKNAYR
AIIHTKPPNLNDIFLATQRAEQILKRTQLMERWANWEISNFEYLMELNTLSGRSYNDITQ
YPVFPWIIADYQSKVLNLDDPSAFRDLSKPVGALNPERLKKFQERYSTFEDPIIPKFHYG
SHYSSAGTVLYYLFRMEPFTTLSIQLQGGKFDHADRMFSDLSGTWDSVVEDMSDVKELVP
EMFYLPEVFTNINSIDFGTTQLGGKLDSVELPPWAENPVDFVHKHRKALESEHVSTHLHH
WIDLIFGCFIMETSFCRYKQRGKDAVMANNVFFYITYEGTVDIDKIADPFHLAADILLKM
LKVQRRAMQDQIAYFGQTPSQLLTVPHMKRKSLRDVLQLQTIFRNPSELKSYVLPNPERC
NVPASTMLVSNDSIVVVDINVPAAHVALHQWQPNTPDGQGTPFLFHHGRNAASSTSGAFM
RMFKGSTSSGEDYEFPRAIGFAASAIRSSAIVAVTCDKDIITGGHADCSVKLISPDGART
IESASGHLAPVTCLALSPDSNYLVTGSRDTTVILWRIHQAGFIHKKNPPEPPPATPRTPR
SPLPTSPSSMSNLLETRKCRIEGPMHVLRGHLGEVISCAVGPDLGLVVSSSNMSGVLLHS
LRTGRLIKKIHVAEAHAVSLSSQGIILVWSESKKRLSSFTVNGVPIATSVLSPFSGGVSC
IEISMDGHFALIGTCSSSNYKCEDNTEVADHEPNKSSRKVDISEQTEIRQSVNVPSICFV
DLHKLKVFHTLELGKGQDITAIALNKENTNLLVSTADKGLMVFTDPALSLKVVDQMLRLG
WEGDGLLQSSESHRC
Download sequence
Identical sequences M8CRZ8
EMT30362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]