SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT31520 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT31520
Domain Number 1 Region: 409-486
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000294
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 142-205
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000451
Family B3 DNA binding domain 0.0071
Further Details:      
 
Domain Number 3 Region: 231-324
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000314
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT31520
Sequence length 487
Comment pep:novel supercontig:GCA_000347335.1:Scaffold4149:151994:156717:-1 gene:F775_23670 transcript:EMT31520 description:"Putative B3 domain-containing protein "
Sequence
MRVDQTLLRKRETKEKIPKIKASGSVKRTQPASIHSLCIVLLWNRYSVHWTRRWWNFFLG
SVKAMGLSSNCAKTIKVQQCVKLPDSKYLHINDELAGCFGTEDHGDGQTALVLSPFGKNA
WPVKHINDELAGCFGTEDHGDGQTALVLSPFGKNAWPVKVDRDAKGAFLGDGWPQFVAAH
GIGVGWYLVIRHEGCGVLTLKAFNASFVIKEFGLTITVLSPAEIENAFARKPQFIVPLQR
SFMEKMPIPPEFLQRGYISEEDLNRPRPIATFLTSWHIELKKDGPNVFFTGSEWPKFLAY
FEIAETDVLLIKYQGCMNFSFETFQNGNNEDIEEKISSSQQSEQSPGAQSQEEEHVCTRK
RKQSEVKSMLDGSTTSQHRKKALCELGSTGSQAWLRKEINELALKRYLHFPARFGFLERC
KITLKSVERNKSWEVEGVNYHPGTRRSYNCLTRGWKAFCKENELKAGDICTFKVVNSTLW
HVVIDRC
Download sequence
Identical sequences M8C2K6
EMT31520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]