SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT33385 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT33385
Domain Number 1 Region: 95-193
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000706
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EMT33385
Sequence length 354
Comment pep:novel supercontig:GCA_000347335.1:Scaffold1022:251994:253208:-1 gene:F775_26577 transcript:EMT33385 description:"Auxin response factor 13 "
Sequence
MAAQFPVDGRWVSSVVALSRLPPPGTEAFYFARGHAEQWPHLPAAPEGHAHGVPCEVTAV
DYFTDGEEPCARITLLPRPHNPPPAAIDIPAPGRFVFYAKQIQQGDWQRSYFQVPKECER
LVPPHQAAGDKQDLLLHDISGNSWNMEHTHRGATRSLSRDWQDLVHEKGVKVRDIIVFVR
CPDGRILVDLRRATPVNRDWGGQEVAQASQLAIEGGAFTVTYYPGRGGESFVVPRAVVDA
AAEREWEVDTPVRLLPKDEVVHVQQQGSASGVIARGTIGAVVPGATTWRSLQVDWDGSTS
STPAVNKWQVEPEGTRDAKRRRLSKTVPPVASTAQRGVKLFGKTLVPEGSGSRS
Download sequence
Identical sequences N1R5L1
EMT33385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]