SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EMT33847 from Aegilops tauschii 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EMT33847
Domain Number 1 Region: 164-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000765
Family B3 DNA binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EMT33847
Sequence length 394
Comment pep:novel supercontig:GCA_000347335.1:Scaffold47:32553:33737:-1 gene:F775_16564 transcript:EMT33847 description:"Uncharacterized protein "
Sequence
MAQAPGDPFPSGLRHADTDAAQSHVGKYLLPLKKRAAPTSDGSDRSSADGSFVVPPKKRR
VVVDTGGEGTSSTHAIPVQSRPRRVAACNVAYASMEEEEAGSSAAGAAGSKKKNRNRNRN
RDSSRKKGPRPARGAAAPLVNRPLHLSVEQQQHLRSLGATAPQFVFMKTLQKSDVERNQN
RLLFSCKREFIQAHPITWLLAEEETYFVHEWGDGLSVSVMDDHDNQFNFKLKYLDSNGGY
RFIGPGWKDFVAENKLLEPVSDGLRFVIELWAFRSPMLPEQPEGPDVEGLKGHPDGTLGF
LFRVYQDESRDVQRGGEEERRPVQKTKRQAPAKAVPSKKLAGQCQAVARDVTRAEIVEAV
GEEMADALFGLLMLRSSGPVPMLKFENTPSAQIC
Download sequence
Identical sequences N1R5J5
EMT33847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]