SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Croqu1|66593|estExt_Genewise1Plus.C_1230023 from Cronartium quercuum f. sp. fusiforme G11 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Croqu1|66593|estExt_Genewise1Plus.C_1230023
Domain Number 1 Region: 6-155
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 7.06e-24
Family Isochorismatase-like hydrolases 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Croqu1|66593|estExt_Genewise1Plus.C_1230023
Sequence length 155
Sequence
MTMTSSDNTALVLVDIQNDFLPPSGTLAVPNGRAILPIVQQLLDFNWKLIVASQDYHPPH
HISFASTHHQEPQFPPKRHAETGIELWPDHCVEGTPGCEIESGILSLLLKLKARAYFVKK
GQDPHKEEYSAFDSSSGVLDQFLRSQQISKIVCIG
Download sequence
Identical sequences jgi|Croqu1|66593|estExt_Genewise1Plus.C_1230023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]