SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384895539|ref|YP_005769528.1| from Helicobacter pylori 35A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384895539|ref|YP_005769528.1|
Domain Number 1 Region: 27-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-69
Family Phosphate binding protein-like 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384895539|ref|YP_005769528.1|
Sequence length 313
Comment hypothetical protein HMPREF4655_20395 [Helicobacter pylori 35A]
Sequence
MFILSNPSLKSIIIKGLTLSQKDFTLISVAHSPDADDIFMYYAIKFGWIDCPIKNKTFHN
IALDIETLNQEALKNTYDVSAISFALFPKIANDYALLPTATSFGNGYGPKLVKKKGMKLK
KDFRVALSGEHTTNALLFKIYYKHARITYMNFLDIEKAVLEEKVHAGLLIHENILDFHNE
LEVEKELWDVWQELIKVDDLPLPLGGMAIRRSIPLYRAILIKKALIKAVEVALKHQNLLS
EMLLERALIRVNMERLQTYLSLYANETSTRLSEIQILAIDKLFELGYQHGFYASLLKAKD
CLLTDEYLQYRFS
Download sequence
Identical sequences E6S4Q4
gi|384895539|ref|YP_005769528.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]