SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001543 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001543
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 3.92e-16
Family LEM domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001543   Gene: ENSAMEG00000001473   Transcript: ENSAMET00000001602
Sequence length 97
Comment pep:known_by_projection scaffold:ailMel1:GL192583.1:1693444:1697359:-1 gene:ENSAMEG00000001473 transcript:ENSAMET00000001602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVKCLSDYELQYELTKLGFSPGPILPSTRKVYEKKLVQLLISPPCASPGMNGPEELDR
AQDDDDSEVFHDPELNATIILKGNIILSSEKNKGPKK
Download sequence
Identical sequences G1L3T3
ENSAMEP00000001543 ENSAMEP00000001543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]