SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000001968 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000001968
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.08e-73
Family Eukaryotic type heme oxygenase 0.000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000001968   Gene: ENSAMEG00000001859   Transcript: ENSAMET00000002047
Sequence length 316
Comment pep:known_by_projection scaffold:ailMel1:GL193163.1:683534:687231:-1 gene:ENSAMEG00000001859 transcript:ENSAMET00000002047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVELETSEGVDESEKKSSGAPEKENHTRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIRKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPTELHRKEALTKDMEYFFGED
WEEKVQCSGAAQKYVERIHYVGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNLKTKERIVEEANRAFEYNMQIFNELDQA
GSLLAKETLEDGLPMHDGKGDVRKCPYYAAKPDRGALEGSSCPFRTALAVLSKPSLQFIL
AAGVALVAGLLAWYYM
Download sequence
Identical sequences G1L508
ENSAMEP00000001968 XP_019660831.1.58354 ENSAMEP00000001968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]