SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003274 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003274
Domain Number 1 Region: 30-118
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 9.15e-22
Family Ribosomal L11/L12e N-terminal domain 0.0000479
Further Details:      
 
Domain Number 2 Region: 107-173
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000000000432
Family Ribosomal protein L11, C-terminal domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003274   Gene: ENSAMEG00000003114   Transcript: ENSAMET00000003405
Sequence length 190
Comment pep:novel scaffold:ailMel1:GL192385.1:2259254:2262143:1 gene:ENSAMEG00000003114 transcript:ENSAMET00000003405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNISRLSSKKEFHVKFLGFSRVVSHPTPATSTMPPKFDPNETKVMSPRCTSGEVGATSSL
ALEDRPRGSVSKKGCYDITKATHDWKGLRITVKLTIQNRQAQIEVVPSASALVIKALKEP
PTDGKKHNIKHSGNATLDEIEQYCLTARELSGTIKEILGTAHSVACNVDGHHPHDIIDDF
KNGAVECPAS
Download sequence
Identical sequences G1L8Q5
ENSAMEP00000003274 ENSAMEP00000003274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]