SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003403 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003403
Domain Number 1 Region: 8-125
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000719
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003403   Gene: ENSAMEG00000003230   Transcript: ENSAMET00000003538
Sequence length 266
Comment pep:known_by_projection scaffold:ailMel1:GL194466.1:153741:173272:1 gene:ENSAMEG00000003230 transcript:ENSAMET00000003538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESVPDLAGYTFLMPAVSVGNVGQLAMDLIISTLNMCKIGYFYTDCLVPMVGNNP
YATAEENSTELSINAEIYSLPSKKLVALQLRSIFIKYKSKPFCEKLLSWVKSSNCAKVIV
LSSSHSYHRNDLQLRSTPFRYLLTPFVQKSVQAKIMSLNWEEMEKSPCIPEIDDSEFCIR
IPGGGITKTLYDEGCSKEIPVVVLLKFVSEGDNIPDALGLVEYLNEWLQIIKPCLQCDDP
TKSALQWKMPSSWRLLFGSGLPPALF
Download sequence
Identical sequences G1L933
ENSAMEP00000003403 XP_011215090.1.58354 ENSAMEP00000003403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]