SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003678 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003678
Domain Number 1 Region: 1397-1536
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.18e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000218
Further Details:      
 
Domain Number 2 Region: 187-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000274
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003678   Gene: ENSAMEG00000003475   Transcript: ENSAMET00000003826
Sequence length 1541
Comment pep:known_by_projection scaffold:ailMel1:GL193170.1:212170:250762:-1 gene:ENSAMEG00000003475 transcript:ENSAMET00000003826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSDNIPEDLRDPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVI
QALSRKGIYVMESDDTPVTDPDLSHAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKR
FSTFSASKELPYDLEDAMVFWVNKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREHPS
ARQPPYFPVLEDLMRDGSDGAALLAVVHYYCPEQMKLDDICLKEVTSMADSLYNIRLLRE
FSNEYLNKCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKT
VSHHKSGRPPVPISNATKRSFLGSPAAASPADTQPPAQPPAEGSHRHRLHDEPEHLGKGA
SAFSPSHPLLPLRQRQQKAVQGEGPPDQRHRSSSLTRVDAQPRGAAVAWPEKKNRPVSQP
APFALHHASSCDMDPGSGDSVSLARSISKDSLASNIINLTPQNQPQPTALKTDGKSLLNN
VDIEDEDEELVAVIRTDVAPHGGDRGLPTNARSPQRLADTLESKPDSFFLEPLMPAVLRP
AKEKQAIAKEEECGEGRPRSFTSKRPSEGHQPLVRKRAPSSHSGRDLSRTFTPISCPELP
AGVDPGPTEPGLQAAGDARGGLPASSGFDLLPQGQSADCFFLHIARADEDTEGRLCVSCA
RSPGARDAEPWAVLRQDSDSDVADLEEAEQDFVGEDHPVVMARYVGEEESAKLQEDMKVK
EHEDKDDASGRSSPCLSTVSQVSSVSMASGSVKMTSFAERKLQRLSSCETKSSTSSSQKT
TPDASESCPAPLTTWKQRREQSPSRQSREHASLLASELVQLHMQLEEKRRAIEAQKKKME
ALSARQRLKLGKAAFLHVVKKGKADGAPQPRKPDHLAGDYAQHNGEDLEGGGCRTEELLL
KEEGREGVLPSPDADAEGPVLLQRHRAKAPALHELEKSRALSAALLEDAGEAVDVSECDL
SIEKLNETISTLQQAILRVSQQQEQLLMKPPAAPAPGMKQNAQDHKVRAAIHFVEPLSPP
GTTGHRRPARLGQGRNARSGRPADLKVPKDRQQASSRSKTPTPSVETLPHLRAFPPRTPS
DPGWDGVAEPGNDPRDKCLFESYRLHDESNQRTFVLSSSKDANILSEQMSLKEVLESSVK
EAGLGSPAISGKEIVPADEPPRSKASLIEVDLSDLKAPDEDGETEGPQSSVDLTSEGDQK
PGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEARRKAEED
RIRKEEEKARRELIKQEYLRRKQQRVLEEQGLGKPKAKPKKPRPKSVHREESCSDSGTKC
SSARKQAGRAGQPRAAEGWPGRASPAATTEPESVHSGGTPSQRVESLEALPTLSRNPSRS
TDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSIL
EELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKSITKKMIDKLYKYSSD
RKQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKTQTRK
Download sequence
Identical sequences G1L9V5
ENSAMEP00000003678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]