SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000003845 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000003845
Domain Number 1 Region: 19-103
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.7e-17
Family Ribosomal L11/L12e N-terminal domain 0.0000609
Further Details:      
 
Domain Number 2 Region: 92-156
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.000000017
Family Ribosomal protein L11, C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000003845   Gene: ENSAMEG00000003647   Transcript: ENSAMET00000004000
Sequence length 173
Comment pep:novel scaffold:ailMel1:GL193109.1:456016:456564:-1 gene:ENSAMEG00000003647 transcript:ENSAMET00000004000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCNCLWPSQIQVYPIPAASTVPPNFDPNESKTVYLRCTCGEVGALALMISLVGLFSKRVS
NDIAKAISDWKGLRIIVKLTIQSRQSQIEMVPSVSALIIKACKEPPRDRKKQKNIKHSGN
ITFDEIVNITSRELSVAIEILWDAQSVGCSVDGHHPHDVTDDIISGTVECPAS
Download sequence
Identical sequences G1LAC2
ENSAMEP00000003845 ENSAMEP00000003845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]