SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006386 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006386
Domain Number 1 Region: 101-292
Classification Level Classification E-value
Superfamily Cytochrome c 1.21e-74
Family Cytochrome bc1 domain 0.00000000655
Further Details:      
 
Domain Number 2 Region: 293-338
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.00000000000000366
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006386   Gene: ENSAMEG00000006052   Transcript: ENSAMET00000006649
Sequence length 338
Comment pep:known_by_projection scaffold:ailMel1:GL192891.1:710027:712297:-1 gene:ENSAMEG00000006052 transcript:ENSAMET00000006649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGRSAARRNPALKDRPRPAPALPGSRGCGLGAGGFPRRARPGPLPLRPSRLGLRPEAVSL
SSKAGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDH
TSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNEDGEMFMR
PGKLSDYFPKPYPNPEAARAANNGALPPDLSYITRARHGGEDYVFSLLTGYCEPPTGVSL
REGLYFNPYFPGQAIGMAPPIYDEVLEFDDGTPATMSQVAKDVCTFLRWASEPEHDHRKR
MGLKMLMMMGLLLPLIYAMKQHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences G1LHJ1
ENSAMEP00000006386 ENSAMEP00000006386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]