SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000006808 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000006808
Domain Number 1 Region: 355-709
Classification Level Classification E-value
Superfamily Urocanase 3.27e-128
Family Urocanase 0.00000173
Further Details:      
 
Domain Number 2 Region: 96-311
Classification Level Classification E-value
Superfamily Urocanase 1.44e-89
Family Urocanase 0.00000733
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000006808   Gene: ENSAMEG00000006448   Transcript: ENSAMET00000007093
Sequence length 734
Comment pep:known_by_projection scaffold:ailMel1:GL192998.1:366272:404428:-1 gene:ENSAMEG00000006448 transcript:ENSAMET00000007093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSWPPLQPQPDMSSLQALCSGLPLRPLPENRGRWAGVPHAPVRTPGLSPAEEQLALRNAL
RYFPPDVQELLAPEFAQELRLYGHIYMYRFCPAMKMTAYPIERYPCRTRAAAAIMHMIMN
NLDPAVAQFPQELVTYGGNGQVFSNWAQFWLMMSYLSQMTEEQTLVMYSGHPLGLFPSSP
QAPRLVITNGMVIPNYSSRTEYEKLFAMGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNA
GRRYLGIKDLAGKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALMKRHEQGWLMEV
TDSLDHCIARLSLIPLEFLSGYRGVPIPGGQTLAAWCWWGWAAAGRCDGPSALLLCPSRE
ARKRKEVLSLGYHGNVVDLWERLVHELDTTGELLVDLGSDQTSCHNPFNGGYYPVQLGFA
EAQSLMACDPTAFKSLVQESLRRQVSAINRLAKENFFFWDYGNAFLLEAQRAGADVEKKG
ANRTEFRYPSYVQHIMGDIFSLGFGPFRWVCTSGDPQDLAVTDELAASVLEEAVADGVDP
AVKLLYTDNIRWIQEAAKHQLVVGSQARILYSDQKGRVAIAVAFNQAIARGKIKAPVVLS
RDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDAFRGATWVALHNGGGVGWGEVIN
GGFGLVLDGTQEAEQKAKMMLSWDVSNGVARRCWSGNQKAYETICQTMQDNKGLVVTLPH
AVAEERVLQQALRP
Download sequence
Identical sequences G1LIQ4
ENSAMEP00000006808 ENSAMEP00000006808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]