SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000007953 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000007953
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 3.79e-43
Family Nip7p homolog, N-terminal domain 0.00000185
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 2.43e-26
Family PUA domain 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000007953   Gene: ENSAMEG00000007542   Transcript: ENSAMET00000008284
Sequence length 180
Comment pep:novel scaffold:ailMel1:GL193010.1:33900:35372:-1 gene:ENSAMEG00000007542 transcript:ENSAMET00000008284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKILKLAANISG
DKLVSLGTCFGKFTKTHKFRLHITALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTCQYQGVVVYSMADVPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Download sequence
Identical sequences D2HLI3
XP_002923248.1.58354 XP_007090417.1.5354 XP_019310972.1.44245 ENSAMEP00000007953 ENSAMEP00000007953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]