SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008214 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008214
Domain Number 1 Region: 46-185
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 2.09e-45
Family Molybdopterin synthase subunit MoaE 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008214   Gene: ENSAMEG00000007797   Transcript: ENSAMET00000008555
Sequence length 189
Comment pep:known_by_projection scaffold:ailMel1:GL192839.1:1220572:1227624:-1 gene:ENSAMEG00000007797 transcript:ENSAMET00000008555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSSFSREMKLPLSPPLVEGSAQQPLGEDLNEVEEKSKDIIKFTTEKLSIDEVS
QLVISPLCGALSLFVGTTRNNFEGKKVISLEYEAYLPMAENEIRKICSDIRQKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRASSLQAVSYAIDTLKAKVPIWKKEMYEESSSSWKRN
KECFWATGD
Download sequence
Identical sequences G1LMH7
ENSAMEP00000008214 ENSAMEP00000008214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]