SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008924 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008924
Domain Number 1 Region: 1014-1153
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.41e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000171
Further Details:      
 
Domain Number 2 Region: 180-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000243
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008924   Gene: ENSAMEG00000008479   Transcript: ENSAMET00000009307
Sequence length 1159
Comment pep:known_by_projection scaffold:ailMel1:GL192871.1:856837:865455:1 gene:ENSAMEG00000008479 transcript:ENSAMET00000009307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHVPSELWEPFYTDQYAQEHVKPPVTRLLLSAELYCRAWRQALPQLETPPSPSALLALLA
RRGTVPALPERPVQEADLRQQPILYGAHLAVIDALMVAFAFEWTKTLPGPLALASLEHKL
LFWVDTTIRRLQEKTEQEAAQRASPVAPADGVAPAQPSIRYRKDRAVARRAPCFPSVTTL
QDLASGAALAATIHCYCPQLLRLEEVCLKEPMSVADSLYNLQLVQDFCASRLPRGCPLSL
EDLLYVPPPLKINLVVLLAEMFMCFEVLKPDFVQAKDLPDGHAASPRATEASPAQNSSGC
SSPVFNFRHPLLSPGGPQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAISFST
PFGLDSDVDVVMGDPVLLRSVSSDSLGPPRPAPARTPVQPSPEPGDLPTIEEALQIIHSA
EPRLLPDGAADGSFYLHSPEGSSKLPLASSYPREGASKPLPDGPAKAPTYVPHPEGPLKP
SPCPAGEVSKPPALSEGSPKAAASSPAASNSEVKMTSFAERKKQLVRAEAEAGSPAATPT
APEALSSEMSELGARLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREAGGEAEA
EPGPVPGGERPAGEGQGDPSPRPKAVTFSPELGPVPPEGLGDYNRAVSKLSAALSSLQRD
MQRLTDQQQRLLAPPEAPGPAPPPAAWVIPGPTVGPRAASPSPARRAPAARRSPGPGPTP
RSPKHARPAELRLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLAEGSPPEPGA
RPGLIEIPLGSLEEPTAEDEGDGSPPGAEDSLEEEASSEGEPRSGLGFFYKDEDKPEDEM
AQKRASLLERQQRRAEEARRRKQWQEAEKEQRREEAARLAQEEVTAGPLAPPAPVAPAAA
PAPAARVPAEEEVGPRRGDFSGGRAPRPRSGCCDDSALARSPARGLLGSRLSKVYSQSTL
SLSTVANEALNNLGVKRPTSQAPSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGP
RLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFR
ALYTLSGETEELTRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQG
HLWQSKKPTTPKKGSSTPK
Download sequence
Identical sequences G1LPE4
ENSAMEP00000008924 ENSAMEP00000008924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]