SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000009909 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000009909
Domain Number 1 Region: 2511-2700
Classification Level Classification E-value
Superfamily BRCA2 helical domain 8.63e-85
Family BRCA2 helical domain 0.0000000381
Further Details:      
 
Domain Number 2 Region: 2863-2999
Classification Level Classification E-value
Superfamily BRCA2 tower domain 3.27e-59
Family BRCA2 tower domain 0.00000276
Further Details:      
 
Domain Number 3 Region: 3084-3216
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.2e-51
Family Single strand DNA-binding domain, SSB 0.00000771
Further Details:      
 
Domain Number 4 Region: 2701-2832
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.23e-43
Family Single strand DNA-binding domain, SSB 0.00000115
Further Details:      
 
Domain Number 5 Region: 2834-2863,3001-3083
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3e-36
Family Single strand DNA-binding domain, SSB 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000009909   Gene: ENSAMEG00000009390   Transcript: ENSAMET00000010341
Sequence length 3460
Comment pep:known_by_projection scaffold:ailMel1:GL192584.1:1852747:1917315:-1 gene:ENSAMEG00000009390 transcript:ENSAMET00000010341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIGCKERPTFFEIFKTRCNEADLGPISLNWFEELSLEAPPSNSEPTEESGYKINYEPNL
FKTPQRKPYHQLASTPIIFRDQGLIVPTYQQSPLKELDKYRLDSGKDITNSKHKSCCTMK
SKMDQTNDVTSPPLNSCLSESPVLRCAHITPQREKSVVCGSLFHTPKLMKGQTPKRISES
LGAEVDPDMSWSSSLATPPTLSSTVLIVVRDEEASAAVFPNDTTAIFKSCFSNHDESRKK
NDRFIPSGPDKENKNQREAKSQGLGKMLGNAFGKVNSCRDHFGKSTPSVLEDEVHETVAD
VSEEDSFSLCVPKYKTNLPKIKTSKTRKNIFNETKTSEYGEAKKQMKENKHSFLSEMEPN
DSDPLDWNVTNQKPFGNGSNKISKKVVPSSASEWSHLTLSGLSGTQMEKTPLLHISSCDQ
NNSEKDFTITEKESTNFITLENSLPQISSVPEYSEMTLNEERVVNKIDEEQCLGTHEDSI
LSLKQAVTETTLIASPLQGIRKSIFRIRESLEETSSAVFSNNMTDPNSKEELEVPESGLE
KHNICSQKEDSLGSVDNGSWSATIKHTSVALKNSGLISTLKKKTKKFIYVINDETSYQGL
KTQKDQESGLTNHSAQFEANAFEGQLTFTNADPGLLHSSPVKKNCLQNDSEEPTVSLTSS
FGTVLRKVSNNGTSSPNGKTVPQDVDYKEAKTNNEKLQSFIITETDCLSSLQEKHCEDDA
KSQRVSNIKQKVLPAVSHPPVPHSEVEGSGIHFHSPESSSSDHDNTSLLTPSSREPPSNP
VVISRVKESHKMSEKLKCKNCEAGFELTKSIPMEKNQEIHVLNANSKNAKLLSSEEYVTV
ASPSMKVQFNQNANLTTIQKDQKETTLISKIAVNPNSEELFPDDENNFILEVTNESNIPV
LGNIKELHDADLCCVREPVLKNSTMMMYTDMEDKQTAKVSIMKDFDSSNIDDLTEENRNG
IKQQLKMTLDQDSKSDITLDIVRKSNGNNGYMNNWARLSDPISNHSFRNGFRTASNKEIK
LSEHNIKKSKMLFKDIEEHYPTNLACIEIIDTSSLESQKKLSKPLALDPQSINSVPGFVK
SSTYVSDSKSGHAAPPTLSLKRDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFKKP
SHIIQKNPFEMPESQLTILNSTSEERRDTDLHLTINAPSITQVDSSKKFEGILGGKQKFA
CLSRTNCNRSASGYLADKNEVQFRGFYSARGIKLNVGSEALQKAKKLFSDLENISEETSV
EVDTRIFYPSKCNDSAVSMIQIEDCNNDKNLNEKNNKSQLILQNNIEMTAGIFVEETTES
YKRKTENEDNQCTDASRNTHNLESVGSDSSKNDTVYIHEEENSFPCIDQRSIDLKLSSQF
MKEGNTQIKEGLSDLTCLEVAKAEETFHVNTSNKQQFTANTMGQSIKDLDIFDVSFHTAS
GKNIRVSKESLNKVINLLDQKWTEEELNNFSDSLNSELLSGTDINKTDISSHEKTENTER
KDKIMKESDLTCTKNKLPTLQQRPESEIKKITAPTMLGFHTASGKKIEIAKESLDKVKNL
FDEKEQDYSGITNFSHQEAKMSKDREECKDGLELACETIELTTAPKYEEMQNSLEEKKLV
CNEIAVGPMLLSDNLYKQTENLKTDCSSLKVKVHEDTEKKTGRKPTIYTNQSTYSAIENS
PLAFYTGHGRKISVSEASLFEAKKWLREGEVDDQPEKINAAKVICLKEYVDDYVENPSCG
NSSSSTITENDKNHLSEKQGSTYLSNSTVSNRYSCHSDFSYSSEVYNKSEYLLKNKVDTP
GFEPVMNNVRERENTSFSEIMSTVREVDTDPQSVNEDICVQRLVTSSSCKNENTAIKVAI
SDSNNFNSIPKLNLDSNNAVPAYGTASSKRIFVAHQTKVTERFTDNCSMVIKQKTKSKSD
TYHVKIVAGYPNALGDSEDIVFPNSLDNAEHSLSSHKAFADIQSEQTLQLNQSISGLEKV
SEIPSCQNNSKIPNICKFSTGNLPKSVPCTNACGIFSTASGKSVQVSDTALQKARQVFSK
IEDSAIQLFPKVSFKNNEQSDKFTNEENTMLHTSQNLLSSAFSGFSTASGKQVPVSESAL
CKVKGMLEEFDLIRTDCGLQHSSTSRQDVSKIPPPSCIDKRALEHCGNSKLEKAYNKEFK
LSSNCNTESASSENHFSIKLSPCPSPLKQDNQQLLLGSRVSLIENIDLLGKEQALAKNIK
TEIGKTETFPNLPVKTNTEICSTYSKDPENYLETETVEIAKAFMEDGELTDSELLSHAKH
SLFTRQNTKETALFSSRIGKRRGDALVSLGEPPIKRNLLNEFDRIIKSQEKSLKASKSTP
DGTLKDRSLFMHHISLEPITCGPFRTTKERQEMQNPNFTAPGQEFLSQSHFCEHGALEKS
SSNLSVSGQPFCTVPATRNEKRRHLNTPGKPVKVFVPPFKTKSHFHRGEQCISKNTNLEE
NKQNLKNIDEHGPGDSETNINDSGIHQLKKNNSNQAAATIIFTKGEKEPLDLITNLQNAR
DTQDMRIKKKQRQHIFPEPGSLYLAKTSTVPRISLRGAVEGQVPSACSHKKLYMYGVSKH
CVKINSKNAESFQFHTQDYFGKEGLWSGEGIQLADGGWLIPSNDGKAGKEEFYRALCDTP
GVDPNLISRVWVYNHYRWIIWKLAAMEFAFPKEFANRCLSPERVLLQLKYRYDVEIDRSR
RSAIRKIMERDDTAAKTLVLCVSEIISSSTDISETSSSKTSSVGAKKGGVVELTDGWYAV
KSQLDPPLSALVKNGRLTVGQKIIIHGAELVGSPDACTPLEAPESLMLKISANSTRPARW
YAKLGFSPDPRPFPLPLSSLFSDGGNVGCVDVVVQRAYPIQWMERTPSGLCIFRNEREEE
KEATKYAEAQQKKLEVLFNKIQGEFEKHDENTTKRYVPSCALTRQQVCALQDGAELYEAV
TNAPDPNYLEDYFSEEQLRALNNHRQMLNDKKQAQIQLEFRKAMESAEQGEQILSRNVTT
VWKLRIISYGKKEKDSVSLSIWRPSSDLYSLLTEGKRYRIYHLATSQSKSKSEKANIQLT
ATKKTQYQQLPASDEILFQVYQPREPLYFNKLLDPDFQPPCSEVDLIGFVVSVVKKIGLA
PLVYLSDESHNLLAIKFWTDLNEDIIKPYTLIAASNLQWRPEAKSGIPTLFAGDSSRFSA
SPKEGHFQERFLKMKNTIENIGMFCNEAENKLMHILNANDPKLSTPTKDYASELHAAQTV
LGMGNKFLMSSPSSEMNHQSPLSFCKLEETSVPTPGSAQMTSKSYCKGEKEMDDPKNCKK
RKALDFLSRLPLPPPVSPICTFVSPAAQKAFQPPRTCGTKHETPIKKKELNSPQMTPHKF
NDLSLLESDSIADEELALINTQALLSGLAGENQLMSLSDSARTAPESSKDYVRPKRHCTA
SGLSGCRSPQARTEERETDGQDASTAKRASMRLQRRQKQK
Download sequence
Identical sequences G1LS71
ENSAMEP00000009909 ENSAMEP00000009909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]