SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011041 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011041
Domain Number 1 Region: 155-257,419-490
Classification Level Classification E-value
Superfamily TrmE connector domain 1.7e-42
Family TrmE connector domain 0.0028
Further Details:      
 
Domain Number 2 Region: 106-186,225-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-29
Family G proteins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011041   Gene: ENSAMEG00000010489   Transcript: ENSAMET00000011514
Sequence length 490
Comment pep:known_by_projection scaffold:ailMel1:GL192348.1:910425:913395:1 gene:ENSAMEG00000010489 transcript:ENSAMET00000011514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRRFWTLVAGAARGPRSPRSCTRQGSGAPVPGSGATVFALSSGQGRCGIAVIRTSGPAS
GHALRSLTAPQDLPPARSACLRLLSHPRSGEPLDRALVLWFPGPQSFTGEDCAEFHVHGG
PAVVSGVYLLAGSVPGLRPAEAGEFTRRAFAHGKLSLTEVEGLADLIHAETEAQRRQALR
QLDGELGHLCRAWAKTLTKALAHVEAYIDFSEDDNLEEGVLERATVDSQVRELELALSAH
LRDARRGQRLRSGAHVVVAGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAG
FPALLSDTAGLREGVGPVEQEGVRRARERVVEWGDRPSTYISPCCIYFVSLPNQEGLLRS
LEWGRQRLLLVLNKSDLLPRGGPDPSPNLPPHLLLSCLTGEGLDGLLEALRKELAEVCGD
PSTGPLLTRARHQHHLQGCLDALGHYKQTKDLALAAEALRLARGHLGRITGGGGTDEILD
IIFRDFCVGK
Download sequence
Identical sequences G1LVE0
ENSAMEP00000011041 ENSAMEP00000011041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]