SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011537 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011537
Domain Number 1 Region: 25-112
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.75e-28
Family Ribosomal L11/L12e N-terminal domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 102-170
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000249
Family Ribosomal protein L11, C-terminal domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011537   Gene: ENSAMEG00000010980   Transcript: ENSAMET00000012028
Sequence length 187
Comment pep:novel scaffold:ailMel1:GL192341.1:4499912:4500489:-1 gene:ENSAMEG00000010980 transcript:ENSAMET00000012028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWPQRRRRCDSLRWSQIRVHPTPAASTMPPKFNPNEIKVLYLRCTSSEVSASSALAPKMG
PLGLAPKTVGDDIAEVTSDWKGLKITVKLTIPNRQAQIEEVPSASALIIKAFDEPPRDSK
KQKNIKHSGNITFDEIVNLWHRSLTRELSGTIKEIGTAQSVGCHADGCHPHDFIDDINSD
AVECPAS
Download sequence
Identical sequences G1LWT4
ENSAMEP00000011537 ENSAMEP00000011537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]