SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000011942 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000011942
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.01e-23
Family Ribosomal L11/L12e N-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 3.27e-18
Family Ribosomal protein L11, C-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000011942   Gene: ENSAMEG00000011350   Transcript: ENSAMET00000012446
Sequence length 192
Comment pep:known_by_projection scaffold:ailMel1:GL193686.1:534937:537875:1 gene:ENSAMEG00000011350 transcript:ENSAMET00000012446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLNRATRALRKPEAGGVIRTIVRAGQAMSGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEI
ARVKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAAFLAAQKE
ADLAAQAEAAKK
Download sequence
Identical sequences G1LXY6
XP_011233800.1.58354 ENSAMEP00000011942 ENSAMEP00000011942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]