SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013240 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013240
Domain Number 1 Region: 1327-1465
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 235-335
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000038
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013240   Gene: ENSAMEG00000012560   Transcript: ENSAMET00000013797
Sequence length 1471
Comment pep:novel scaffold:ailMel1:GL192393.1:1336712:1445717:-1 gene:ENSAMEG00000012560 transcript:ENSAMET00000013797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPGVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEPVNDMPS
ISVLNAAKTNILDSSCSSDFTSSGEGAAFTHTHHLPSRHSRPQAHSSASVEGGIRRSSSM
SYVDGFIGTWPKEKRSSVHGVSFDISFDKENTVHRSTPNRGITRSISNEGLTLNNNRVSK
NIRKNLSFKPVNGEEEAESIEEELNIDSHSGLKSYMPLNTNELNSNENIHYKLPNGALQN
RVLLDEFGNQIETPSIEEALQIIHDTEKSPHTSQPDHIANGFFLHNQEMSILNSNIKLNQ
SSPDNITDTKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKF
LQDYDIRTSNPREALSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSG
SSSQKTTPEGSELNIPHVVAWGQIPEEAGLPQGRDTTQLLASEMVHLRMKLEEKRRAIEA
QKKKMEAAFTKQRQKMGRTAFLTVVKKRGDGISPLREEAAGAEDEKVYTDRAKEKDSQKA
NGQRSKSLADLKESMENPQAKWLKSPTTPVDPEKQWNLASPSEETLNEGEILEYTKSIEK
LNSSLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKPSRQAGLSSAIA
PFSSDAPRPTHPSPQSSNRKSTSFSVKNQRTPRPNELKITPLTRTLTPPRSVDSLPCFGD
DGEPQLKESKPKEEIKKEELESQGQHVQNPEEKEIKPLESTVSEVLSQPITETVRLTPSE
DQLNPPAEPPPKPVFPPAAPKNVNLIEVSLSDLKPPEKADVAVEKYDGESDKEQFDDDQK
VCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEAEMEHKKEETRRKTEEE
RQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQIAKQKKQRPKSIHRDHIESPK
TPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLSPSRCGSRNGEKDWENASTT
SSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEMEKSDANNF
LILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQFSHIPAKT
LSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences G1M1M9
ENSAMEP00000013240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]