SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013245 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013245
Domain Number 1 Region: 1343-1481
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 235-335
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000038
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013245   Gene: ENSAMEG00000012560   Transcript: ENSAMET00000013802
Sequence length 1487
Comment pep:novel scaffold:ailMel1:GL192393.1:1336715:1445717:-1 gene:ENSAMEG00000012560 transcript:ENSAMET00000013802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREMRKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELREPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKLKEHHTVEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPGVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEPVNDMPS
ISVLNAAKTNILDSSCSSDFTSSGEGAAFTHTHHLPSRHSRPQAHSSASGGIRRSSSMSY
VDGFIGTWPKEKRSSVHGVSFDISFDKENTVHRSTPNRGITRSISNEGLTLNNNRVSKNI
RKNLSFKPVNGEEEAESIEEELNIDSHSGLKSYMPLNTNELNSNENIHYKLPNGALQNRV
LLDEFGNQIETPSIEEALQIIHDTEKSPHTSQPDHIANGFFLHNQEMSILNSNIKLNQSS
PDNITDTKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQ
DYDIRTSNPREALSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSS
SQKTTPEGSELNIPHVVAWGQIPEEAGLPQGRDTTQLLASEMVHLRMKLEEKRRAIEAQK
KKMEAAFTKQRQKMGRTAFLTVVKKRGDGISPLREEAAGAEDEKVYTDRAKEKDSQKANG
QRSKSLADLKESMENPQAKWLKSPTTPVDPEKQWNLASPSEETLNEGEILEYTKSIEKLN
SSLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQIRDFKPSRQAGLSSAIAPF
SSDAPRPTHPSPQSSNRKSTSFSVKNQRTPRPNELKITPLTRTLTPPRSVDSLPRLRRFS
PSQVPIQTRSFVCFGDDGEPQLKESKPKEEIKKEELESQGQHVQNPEEKEIKPLESTVSE
VLSQPITETVRLTPSEDQLNPPAEPPPKPVFPPAAPKNVNLIEVSLSDLKPPEKADVAVE
KYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEA
EMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQIAKQK
KQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLSPSR
CGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQ
KKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLY
KYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences D2GZP3
XP_019650080.1.58354 ENSAMEP00000013245 ENSAMEP00000013240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]