SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014135 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014135
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000186
Family LEM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 259-404
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000435
Family Ankyrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000014135
Domain Number - Region: 159-195
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00837
Family N-terminal domain of RNase HI 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014135   Gene: ENSAMEG00000013418   Transcript: ENSAMET00000014731
Sequence length 903
Comment pep:novel scaffold:ailMel1:GL193005.1:357934:373479:1 gene:ENSAMEG00000013418 transcript:ENSAMET00000014731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEMTMDAILARLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEHGRTLPSH
PPGLDTSGATTLSQDAQRILKSAVGSQAEQVGLSEDRDFGYSVGLNPPEEDVVTSKTCSV
PFSAATGVSGHKAVARASTEPPLYYGVCPAYEDTPARNEKIHVYEDRKEALQAVKMIKGS
RFKAFSSREDAEKFARGICDYFPSPSKASLPLSPVKIAPLFSSGGLKDGLYSSESETINR
ERANSYKTPRTQDLTAKLRKAVEKGEEETFSDLTWSNPRYLIGSGDNPTIVQEGCRYNVM
HVAAKENQASICQLTLETLENPEFMRLMYPDDDASMLRQRICYIVDLYLNTPDKVGYDTP
LHFACKFGNADVVNVLSSHPLIVKNPRNKYDKTPEDVICERSRNKSVELKEQIREYLKGH
YYVPLLRAEDTSSPVIGELWSSDQTTETSHIGHGGGGPRDPVLTLRAFAGPLSPSKAEDF
RRLWKTPPREKAGFFHNVRKTDPERGTERVGRELAHELGYPWVEYWDFLGCFVDLSSQEG
LQKLEEYLTHQEAGKNAQQDSEENEACRQENPSAFGRARKCSNSISVRAFLDEDDDLSLE
EIKNRQNTARNNTQPTISAFGDAKCDILPLEQETNLIEAATLPSPHSSKNGFCSPLSGNR
TLGRKKPEAPSVGEALLSPVSGLTVEFDKLNLQGLGSNFSKTPNKNMNTRDKKSLTSRMD
AVERDSLELPAADTVTNNQARTESEMSAEMAKIRLGPDAPVQEAQQRCGSVSSEPSGVPG
AKEPVQGLFLFGEEPSKLDRDVLAALECTVVDPQEYPAVHRWKSAVLCYSPSDRQSWPSP
ALKGKPVSQQLDLGCPHSCSPGRSPGKPGPTPHSPGLGSPGRYSPASGSHLRRMARLAQL
TAL
Download sequence
Identical sequences D2HLF9
ENSAMEP00000014135 ENSAMEP00000014135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]