SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014302 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014302
Domain Number 1 Region: 138-253
Classification Level Classification E-value
Superfamily EndoU-like 5.49e-27
Family Eukaryotic EndoU ribonuclease 0.00078
Further Details:      
 
Domain Number 2 Region: 90-129
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000327
Family Somatomedin B domain 0.0024
Further Details:      
 
Domain Number 3 Region: 21-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000114
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014302   Gene: ENSAMEG00000013582   Transcript: ENSAMET00000014902
Sequence length 256
Comment pep:known_by_projection scaffold:ailMel1:GL192744.1:1024815:1033633:-1 gene:ENSAMEG00000013582 transcript:ENSAMET00000014902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACVPLIVAILCSLAWAGKLESCASRCNEKFHRDAACQCDHQCPRHGDCCEDSEHLCTV
EEDPEEPEPFLGLEEEVLEAPASNLYTAPSSCRYRCHEAFDRHQPCHCNARCPEFGNCCK
DFESLCGHEGFSYSRDAITKEGLQSISEKIYRADINKAQKEDIILNSQNRILPSETRDQV
DRCPEPLFTYVNEKLFSKPTYAAFISLLNNYQRATGRGEHFDGQQLAEQDAFLREVMKTA
VMKELYGFLRHQSEAS
Download sequence
Identical sequences G1M4N5
ENSAMEP00000014302 ENSAMEP00000014302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]