SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000014683 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000014683
Domain Number 1 Region: 16-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.75e-37
Family Ribosomal protein L20 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000014683   Gene: ENSAMEG00000013932   Transcript: ENSAMET00000015290
Sequence length 149
Comment pep:known_by_projection scaffold:ailMel1:GL194360.1:245777:249903:-1 gene:ENSAMEG00000013932 transcript:ENSAMET00000015290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVPFAPEVLARPLITDRYWRVQEVLQHARHFRGRKNRCYRLAVRAVTRAFVKCTKARRLK
KRNMRTLWINRITAASQEHGLKYPAFIVNLIKCQVELNRKVLADLAIYEPKTFKSLAALA
KRRRQEGFAAALGDGKEPEGIFSRVVQHH
Download sequence
Identical sequences G1M5R5
ENSAMEP00000014683 ENSAMEP00000014683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]