SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000015875 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000015875
Domain Number 1 Region: 169-244,287-378
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000294
Family C-terminal domain of adrenodoxin reductase-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000015875   Gene: ENSAMEG00000015063   Transcript: ENSAMET00000016535
Sequence length 549
Comment pep:known_by_projection scaffold:ailMel1:GL193017.1:931731:954643:-1 gene:ENSAMEG00000015063 transcript:ENSAMET00000016535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVWCCRCSLAGHFRNYSDTETEGEIFNSFVQYFGDNLGQKVKAMPLVEETSLLEDSSVT
LPMVVIDLSPLFCIYLMFICYRPYLSSEAMHPNTILHSKLEEARHLSIVDQDLEYLSEGL
EGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHLVLGKGPPGGAWHNMEGS
MLTISFGNWMELPGLKFKDWVSSKRRNLKGDRVMPEEIARYYKHYVKVMGLQKNFRENTY
ITSVSRLYRDHQDGDDGQDRNISTQHLQIEKSTFIKRNWEIRGYQRIADGSHVPFCLFAE
NVALATGTLDSPAHLDIEGEDFPFVFHSMPEFGAAISQGKLRGKVDPVLIVGSGLTAADA
VLCAYNNNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMMCTQSYSVDSNLLSDYT
SFPEHHVLSFTSDMKCILQSLSGLKKIFKLSAAVVLIGSHPNLSFLKEQGCYLGHNSSQP
ITCKSNPVEIDAYTYECVKEANLFALGPLVGDNFVRFLKGGALGVTCCLATRQKKKHLFV
ERGGGDGIA
Download sequence
Identical sequences G1M955
ENSAMEP00000015875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]