SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000016041 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000016041
Domain Number 1 Region: 203-386
Classification Level Classification E-value
Superfamily vWA-like 0.00000000395
Family Integrin A (or I) domain 0.042
Further Details:      
 
Domain Number 2 Region: 691-799
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000785
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000016041   Gene: ENSAMEG00000015187   Transcript: ENSAMET00000016711
Sequence length 1251
Comment pep:known_by_projection scaffold:ailMel1:GL193175.1:647482:844317:-1 gene:ENSAMEG00000015187 transcript:ENSAMET00000016711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLGACWLLGAVADADFSILDEAQVLASQMRRLAAEELGVVTMQRIFNSFVYTEKISNGES
EVQQLAKKIREKFNRYLDVVNRNKQVVEASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFN
TNVSRTISCDRLSTTVNSRAFNPGRDLNSVLADNLKSNPGIKWQYFSSEEGIFTVFPAHK
FRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAARVILSAIDEHDK
ISVLTVADTVRTCSLDQCYKTFLSPATSETKRKMSTFVSSVKSLDSPTQHAVGFQKAFQL
IRSTNNNTKFQANTDMVIIYLSAGITSKDSSEEDKKATLRVINEENSFLNNSVMILTYAL
MNDGVTGLKELAFLRDLAEQNSGKYGVLDRTALPVIKGSMMVLNQLSNLETTVGRFYTNL
PNRMIDEAVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSL
ASYTFLIDDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQII
AVPVNSSLSWHINKLRATGKEAYNVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVP
SSKLLYHRLDLLGQPSACLHFKQLATLESPTVMLSAGSFSSPYEHLSQPETKRMVEHYTA
YLSDNTRLIANPGLKFSVRNEVMATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIY
PGSLMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGH
TVAVMGIDFTLRYFYKVLMDLLPVCNQDGGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVE
QQHITHKEPLVANDILNHPNFVKKNLCNSFSDRTVQRFYKFNTSLVGDLTNLVHGSHCSK
YRLARIPGTNAFVGIVNETCDSLAFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECT
GNLTNAENRNPSCEVHQEPVTYTALDPGLQDALHQCVNSRCSQRMESGDCFGVLDCEWCM
VDSDGKTHLDKSYCAPQKECFGGIVGAKSPYVDDMGAIGDEVVTLNMIKSAPVGPVAGGI
MGCIMVLVLAVYAYRHQIHRRSHQHMSPLAAQEMSVRMSNLENDRDERDDDSHEDRGIIS
NTRFIAAVIERHAHSPERRRRYWGRSGTESDHGYSTMSPQEDSENPPCNNDPLSAGVDVG
NHDEDLDLDTPPQTAALLSHKFHHPRPHHPTLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences G1M9M0
ENSAMEP00000016041 ENSAMEP00000016041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]