SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000016941 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAMEP00000016941
Domain Number - Region: 50-132
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0248
Family 2-methylcitrate dehydratase PrpD 0.035
Further Details:      
 
Domain Number - Region: 114-150
Classification Level Classification E-value
Superfamily Cysteine alpha-hairpin motif 0.0471
Family COX17-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000016941   Gene: ENSAMEG00000016050   Transcript: ENSAMET00000017637
Sequence length 156
Comment pep:known_by_projection scaffold:ailMel1:GL193341.1:335211:338611:1 gene:ENSAMEG00000016050 transcript:ENSAMET00000017637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGSRSRTSRMAPPASRAPQMRAAPRPAPPAQPPAVAPPSAVGSPAAAPRQPGLMAQMA
TTAAGVAVGSAVGHTIGHAITGGFSGGSNAEPSRPDITYQEPQGTQPAYQQQQQQFGPCH
YEMKQFLECAQNQGDLKLCEGFSEVLKQCRFANGLA
Download sequence
Identical sequences G1MC63
ENSAMEP00000016941 ENSAMEP00000016941 XP_002925843.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]