SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017648 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017648
Domain Number 1 Region: 25-113
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.01e-34
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 102-175
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.96e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000017648   Gene: ENSAMEG00000016712   Transcript: ENSAMET00000018368
Sequence length 192
Comment pep:novel scaffold:ailMel1:GL192475.1:2241861:2245287:-1 gene:ENSAMEG00000016712 transcript:ENSAMET00000018368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSARRRQRCNCLRSSRIRVHPTPATSAMPPKFDPNEIKVVYLRCTGGEVGATSALAPKIG
PLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRK
KQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIID
DINSGAVECPAV
Download sequence
Identical sequences G1ME70
ENSAMEP00000017648 ENSAMEP00000017648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]