SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000017696 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000017696
Domain Number 1 Region: 333-461
Classification Level Classification E-value
Superfamily Plus3-like 2.62e-46
Family Plus3 0.00000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000017696   Gene: ENSAMEG00000016738   Transcript: ENSAMET00000018417
Sequence length 687
Comment pep:known_by_projection scaffold:ailMel1:GL192356.1:2925007:2973938:-1 gene:ENSAMEG00000016738 transcript:ENSAMET00000018417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQEGSPGGVRRASRGTTMVKKRKGRVVIDSDTEDSGSDENLDQELLSLAKRKRSDSEEKE
PPVSQPAASSDSETSNSDDEWTFGSNKNKKKGKARKIEKKGTMKKQANKTASSGSSDKDS
SAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHDGYGEDLMGDEEDRARLEQMTEKE
REQELFNRIEKREVLKKRFEIRKKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSH
NKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDK
SSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVT
GCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVS
NQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFNDQDIEEIVKEKERFR
KAPPNYAMKKTQLLKEKAMAEDLGDQDKAKQIQDQLNELEERAEALDRQRTKNISAISYI
NQRNREWNIVESEKALVAESHNMKNQQMDPFTRRQCKPTIVSNSRDPAVQAAILAQLNAK
YGSGVLPDAPKEMSKGQGKDKDLNSKSASDLSEDLFKVHDFDVKIDLQVPSSESKALAIT
SKAPPAKDGAPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences G1MEB8
ENSAMEP00000017696 ENSAMEP00000017696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]