SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000018630 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000018630
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.01e-41
Family Nucleoplasmin-like core domain 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000018630   Gene: ENSAMEG00000017639   Transcript: ENSAMET00000019376
Sequence length 177
Comment pep:novel scaffold:ailMel1:GL192371.1:911642:913206:-1 gene:ENSAMEG00000017639 transcript:ENSAMET00000019376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGTAAALAFLSQESRTRAGGIGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDA
EHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPV
TFRLKSGSGPVRITGRHQIVTISNDVSEEEESEEEGSEEEEAELCPILPAKKQGGRP
Download sequence
Identical sequences D2GXV0
XP_002913918.1.58354 ENSAMEP00000018630 ENSAMEP00000018630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]