SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019216 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019216
Domain Number 1 Region: 682-773
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000127
Family Canonical RBD 0.021
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily LEM domain 0.000000000000569
Family LEM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019216   Gene: ENSAMEG00000018169   Transcript: ENSAMET00000019980
Sequence length 813
Comment pep:known_by_projection scaffold:ailMel1:GL192723.1:1117630:1177049:1 gene:ENSAMEG00000018169 transcript:ENSAMET00000019980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRGNKTRNS
NNNNTASPTCGLLGAWAESRPRARRAPWEGPGAPRPPKVLLGFSSDESDVEASPREQAGG
GGGGRKDRASLQYRGLKPLSAPLSASEVTNSNSAERRKPHSWWGARRPAAPELQTPSARD
GAAEDEEEEGEDGGDGDPEAEEPLWASRTVNGSRLLSYSCRENYSDSEEEEDDDVASSRQ
TAKSAGGRLETSVQGGGGIPMNDRAAAAGSLDRSRNLEESAAAAAEQGGGCSLLKTNNHI
GGGAFSVDSPRIFSNSLPPGASVAASSSLRINHSNHTGSNHTYLKNTYNKPKLSEPEEEL
LQQFKREEVSPTAGFSAHYLSMFLLTAACLFFLILGLTYLGMRGTGVSEDGGLSRESELN
TKESKKNLMMNTLYKLHDRLAQLAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEDIFNIS
LKWILENGKDVGIRCVGYGPEEQLTNITDVQFLQSTRPQMSFWCRFRRAFITVTHRLLLL
CLGVVMVCVVLRYMKYRWTKEEEETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPH
VQDSLIQPPDKKKMKKVWDRAVDFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKIL
VIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDND
GIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQA
LTCNTPLKPSNKHMNSMSHLRLRTGLANSQGGS
Download sequence
Identical sequences G1MIN1
ENSAMEP00000019216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]