SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000019546 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000019546
Domain Number 1 Region: 27-124
Classification Level Classification E-value
Superfamily AlbA-like 2.35e-20
Family DNA-binding protein AlbA 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000019546   Gene: ENSAMEG00000018492   Transcript: ENSAMET00000020315
Sequence length 163
Comment pep:novel scaffold:ailMel1:GL194301.1:21293:21784:1 gene:ENSAMEG00000018492 transcript:ENSAMET00000020315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGS
GRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPVSPDTGLDPLTVRRHVPAVWVL
LSRDPLDPNECGYQPPGAPPGLGPTSSSSCGPRPRRRVRDTWS
Download sequence
Identical sequences D2I3E7 M3VZT6
9685.ENSFCAP00000002904 ENSFCAP00000002904 ENSAMEP00000019546 XP_002929757.1.58354 XP_003995624.1.62641 XP_004392268.1.74151 XP_006939293.1.62641 XP_006939294.1.62641 XP_007076609.1.5354 XP_007076610.1.5354 XP_007076611.1.5354 XP_007076612.1.5354 XP_011286880.1.62641 XP_014928598.1.86478 XP_014928606.1.86478 XP_014928613.1.86478 XP_014928619.1.86478 XP_014928622.1.86478 XP_019279639.1.44245 XP_019279640.1.44245 XP_019279641.1.44245 XP_019665993.1.58354 ENSAMEP00000019546 ENSFCAP00000002904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]