SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000020082 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000020082
Domain Number 1 Region: 29-117
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 7.46e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000756
Further Details:      
 
Domain Number 2 Region: 106-179
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.57e-16
Family Ribosomal protein L11, C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000020082   Gene: ENSAMEG00000019012   Transcript: ENSAMET00000020851
Sequence length 196
Comment pep:known_by_projection scaffold:ailMel1:GL194486.1:52959:53549:-1 gene:ENSAMEG00000019012 transcript:ENSAMET00000020851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLFWLSARRRQRCNCLRSSRIRVHPTPATSAMPPKFDPNEIKVVYLRCTSGEVGATSALA
PKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEAVPSASALIIKALKEPP
RDRKKQKNIKHSGNITFDEIVNIVRQMRHRSLARELSGTIKEILGMAQSVGCNVDGRHPH
DIIDDINSGAVECPAS
Download sequence
Identical sequences G1ML47
ENSAMEP00000020082 ENSAMEP00000020082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]