SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000020780 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000020780
Domain Number 1 Region: 285-446
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-47
Family SPRY domain 0.000054
Further Details:      
 
Domain Number 2 Region: 4-76
Classification Level Classification E-value
Superfamily RING/U-box 6.13e-19
Family RING finger domain, C3HC4 0.0046
Further Details:      
 
Domain Number 3 Region: 91-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000626
Family B-box zinc-binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSAMEP00000020780
Domain Number - Region: 130-239
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00549
Family Apolipoprotein A-I 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000020780   Gene: ENSAMEG00000019734   Transcript: ENSAMET00000021549
Sequence length 453
Comment pep:novel scaffold:ailMel1:GL193581.1:225452:226810:-1 gene:ENSAMEG00000019734 transcript:ENSAMET00000021549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TASLAELQAEASCPICLEYLRDPVTTECGHNFCGFCIHQCWEDLQDILPCPVCLHHCPDR
NLKRNMQLGHMTDLVKQLPARRSKRKLLEDKVLCEQHSQALALFCEKDLELLCPQCKVSS
GHQGHPLTPIEQAAAGHRKKLKSYIEPLKKQIEDTEKGLKMQVSNLFELRRKVENRKHKL
HSDFEQFKHFLGKEQSAVHIRLLIEENHVQEKIIESKNQMLDHHSTLRSLLSEITKKCLQ
TDLDLLTGIESIHNTYEHLQPPAAFSYELKKEVCSLPPQYFGLQKMISTFQVDLTLDPKT
AYHTLLISQDRKTATFQKMKPSRAHNPQAFTSYPAVLSCEGFEAGRHFWQVEVTGTGEWS
LGVCKESFPRNALLSPSPNNGCWQIQFWTRTLGTEDSGNLRQIGIFLDYELGEVSFYSLS
NRSHLYTFSEFFTEKLMPYFSIGPSSESLKISI
Download sequence
Identical sequences G1MN31
ENSAMEP00000020780 ENSAMEP00000020780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]