SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000020898 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000020898
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.83e-21
Family Ribosomal protein L39e 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000020898   Gene: ENSAMEG00000019848   Transcript: ENSAMET00000021667
Sequence length 51
Comment pep:known_by_projection scaffold:ailMel1:GL193961.1:306063:306215:1 gene:ENSAMEG00000019848 transcript:ENSAMET00000021667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHKTFRIKRFLAKKQKQNRPIPQWIQMKTGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences A0A287CZL3 A0A2K5E203 A0A2K5XCA0 F7EL88 G1MNE9 H0VAC5 L8IK14
ENSMMUP00000004408 ENSAMEP00000020898 ENSAMEP00000020898 10141.ENSCPOP00000006801 9544.ENSMMUP00000004408 ENSSTOP00000022781 XP_002928959.1.58354 XP_003477798.1.53824 XP_005895679.1.15283 XP_006745732.1.47382 ENSCPOP00000006801 ENSMMUP00000004408 ENSSTOP00000022781 ENSCPOP00000006801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]