SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002044 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002044
Domain Number 1 Region: 482-737
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 181-420
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 785-1044
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 2-130
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-28
Family YWTD domain 0.0000407
Further Details:      
 
Domain Number 5 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1175-1213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 437-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1096-1136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1137-1173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000658
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1054-1107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000286
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002044   Gene: ENSAMEG00000001930   Transcript: ENSAMET00000002127
Sequence length 1463
Comment pep:novel scaffold:ailMel1:GL193194.1:33001:133470:1 gene:ENSAMEG00000001930 transcript:ENSAMET00000002127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTLDYEEQKLYWADAKLNFIHKSN
LDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMD
IHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATEL
LLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFID
GSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRA
IVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAK
TDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREIIID
QLPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVP
EAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAF
MNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSP
RALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDL
DTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQ
GHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCS
APTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIR
KAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGV
VLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALD
SRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKI
DMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSC
PMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSE
SQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCSNGQCIGKHKKCDHNVD
CSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMT
NDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASS
SSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTT
PCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPS
PYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences D2HQT0
ENSAMEP00000002044 ENSAMEP00000002044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]