SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000002061 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000002061
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.51e-33
Family Ras-binding domain, RBD 0.0028
Further Details:      
 
Domain Number 2 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000002061   Gene: ENSAMEG00000001945   Transcript: ENSAMET00000002144
Sequence length 623
Comment pep:known_by_projection scaffold:ailMel1:GL193622.1:404879:466407:-1 gene:ENSAMEG00000001945 transcript:ENSAMET00000002144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESNEDIDQMFSNLLGEMDLLTQSLGVDTLPPPDPKPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQNQHHAASLAVPDFSGAVALGYGANVTAVS
VSQYEDDLPPPPADPMLDLPLPPPPPEPLSQEEEAAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYTELQIERIFEDHENV
VEVLSDWTRDTENKVLFLEKEEKYAVFKNPQNFYLDNKGKKEGKETNEKMNAKNKESLLE
ESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGIQCKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDARTLNQWVMGIRIAKYG
KTLYDNYQRAMERAGLASRWSNLGTVNAAPPAPSSTGLKTGTTQANGQIPQAAHSVSAVL
EEAQKHAETIKDKKPALGNHHLGAPRAPQLPKSSLPPPPPVRRSSDVCGSPATVPRAKGL
SGGFPAPPPSFAEAAGSPLPPPPPPPPAPAPEAAKPPPAGVKRAPVPPKRKENPGPPGGG
GSGEQDFMSDLMKALQKKRGNMS
Download sequence
Identical sequences G1L5A0
XP_002927568.1.58354 ENSAMEP00000002061 ENSAMEP00000002061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]