SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008077 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008077
Domain Number 1 Region: 656-731
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 6.41e-28
Family AN1-like Zinc finger 0.0000115
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.38e-25
Family Ubiquitin-related 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008077   Gene: ENSAMEG00000007628   Transcript: ENSAMET00000008412
Sequence length 736
Comment pep:known_by_projection scaffold:ailMel1:GL193399.1:421254:489783:1 gene:ENSAMEG00000007628 transcript:ENSAMET00000008412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNRKDPPFFNEDNVGPFYYKLPFCDTMELFIETLTGTCFELRVSPFEAVISVKAKIQRL
EGIPICQQHLIWNNMELEDDYCLNDYNISEGCTLKLVLAMRGGPINTRRVPMEDPLREMA
EYLDSSQDEVWEKTSCNKQVTFLVYREGDQLNFFRVVDRGDGTLTPLSESLSVCARVQVH
THSLKKMGRNKRSGGSVYNLYTDEDEEIEPSPSGQQIIENSITMNKMKLLKAKMENMNLS
KKPKKAVKVKPHPPIAPRPSSSSMAAARHRLLRVLPHVGQSCLPSPGNADLPETSSNAVS
SLATLPPADRPISSIASDFLKEDDNWKSNTLSHSNSSIKLPPQIPHMELENDKELADSVL
HLGSSLPRRTKHFSGNLSSNNEDDTVLFSTSEECVTEESLLPEVGSFATFTEGNTDEQSS
GLEVTQKVNPEFLLTNDDKGLKAAEQHLKHVARMLSGESVETTVLNHRELSPHKNRLLSP
LRCSTPMSLHNSRVKSQRQSKCFESGNLQSSASQNVLQSLDVRNITGSSFSRTTRFRAVK
VNSPGKRSDMISKVEARDITEMANKASKEPVGCVNNIGFLASLARSASRDSLQSTRGAGR
LRTSGIGLSASLQHFQEESLRKNSPQLEPIDFFLSARGIGMNGNNTAAGKRVGECTHHLP
PVNAPIQTKKKATKHCFLCGKKTGLATSYECRCGNNFCASHRYAETHSCTYDYKSAGRRY
LQEANPVVNAPKLPKI
Download sequence
Identical sequences G1LM87
ENSAMEP00000008077 ENSAMEP00000008077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]