SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000008572 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000008572
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 6.8e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000414
Further Details:      
 
Domain Number 2 Region: 130-241
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.06e-25
Family Middle domain of MutM-like DNA repair proteins 0.00000237
Further Details:      
 
Domain Number 3 Region: 245-287
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.23e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000008572   Gene: ENSAMEG00000008129   Transcript: ENSAMET00000008934
Sequence length 387
Comment pep:known_by_projection scaffold:ailMel1:GL193224.1:95420:100438:1 gene:ENSAMEG00000008129 transcript:ENSAMET00000008934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASRFVNEACRGLVFGGCVEKSPVSRNPEVPFESSAYCISSSARGKELRLTL
SPLPGAQPPRGPLALVFRFGMSGSFQLAAQDALPAHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGEWQGPCVLLEYERFRENVLRNLADKVFDQPICEALLDQRFFNGIGNYLRAEIL
YRLRIPPFEKARKVLEALQQRRPSPELTLSQKIRAKLRNPDLLELCHSVPKEVVQLGGKG
YGLESGEEDFAAFRAWLRCYGMPGMSSLRDRRGRTIWFQGDPGPLAPKGGKSHKKKSKGA
RQGPEHRMEDPLLPSTAPSRTRGARRGPPEQSTAQQPEGTSLQQDPEVPPVPKKGKRRRR
PATSGHRRPRRIKADTPSLENEGMAAS
Download sequence
Identical sequences G1LNE4
ENSAMEP00000008572 ENSAMEP00000008572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]