SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMEP00000013577 from Ailuropoda melanoleuca 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMEP00000013577
Domain Number 1 Region: 193-286
Classification Level Classification E-value
Superfamily TAFH domain-like 1.83e-35
Family TAFH domain-like 0.00000302
Further Details:      
 
Domain Number 2 Region: 479-526
Classification Level Classification E-value
Superfamily Histone-fold 2.43e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMEP00000013577   Gene: ENSAMEG00000012885   Transcript: ENSAMET00000014144
Sequence length 695
Comment pep:known_by_projection scaffold:ailMel1:GL192744.1:796876:863642:-1 gene:ENSAMEG00000012885 transcript:ENSAMET00000014144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTPTGLPKGSASAGPQSLPRTPSATTGGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPG
MVLVRSENGQLLMIPQQALAQMQAQAHVQTQPQTTMAPRPATPTSAPPVQISTVQAPGTP
IIARQVTPTTIIKQVSQAQTTVQPNTALQRSPGVQPQLVLGGAAQTTSLGTATAVQTGTP
QRTVPGATTTSTAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQSLLDGRI
EAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPASQATTAL
TAVVLSSSVQRTAGKTAATVTSALQPPVISLTQPTQVGVGKQGQPTPLVIQQPPKPGALI
RPPQVTLTQTPMVALRQPHSRIVLTAPQQIQLNQLAPLPVVKPAVLPGTKALSAVSAQAA
AAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFL
LPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDR
YEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEKTK
MQQQELAQMRQRDANLTALAAIGPRKKRKVDSPGPGSGTESAGPGSAVPGSSGVGTPRQF
TRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences G1M2L6
ENSAMEP00000013577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]